Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Telomerase protein component 1 (TEP1), partial

This Recombinant Human Telomerase protein component 1 (TEP1), partial spans the amino acid sequence from region 2-226aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Telomerase-associated protein 1 ; Telomerase protein 1p240p80 telomerase homolog

UniProt

Q99973

Expression Region

2-226aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCWCC1 Rabbit Polyclonal Antibody (BF647)
orb2438380 100 µL

ZCWCC1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SIK3 (NM_001281748) Human Tagged ORF Clone
RC239969 10 µg

SIK3 (NM_001281748) Human Tagged ORF Clone

Sign In for Pricing
View Details
Surfactin
TRC-S860003-2.5MG 2.5 mg

Surfactin

Sign In for Pricing
View Details
Recombinant Wnt5a Monoclonal Antibody
E-AB-81621-01 50 µL

Recombinant Wnt5a Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Wnt5a Monoclonal Antibody
E-AB-81621-02 100 µL

Recombinant Wnt5a Monoclonal Antibody

Sign In for Pricing
View Details
SLC22A3 Blocking Peptide
33R-7016 100 ug

SLC22A3 Blocking Peptide

Sign In for Pricing
View Details