Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Neutral trehalase (NTH1), partial

This Recombinant Saccharomyces cerevisiae Neutral trehalase (NTH1), partial spans the amino acid sequence from region 3-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha, alpha-trehalaseAlpha, alpha-trehalose glucohydrolase

UniProt

P32356

Expression Region

3-221aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM164B HDR Plasmid (h)
sc-414743-HDR 20 µg

FAM164B HDR Plasmid (h)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-01 20 µL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-02 100 µL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-03 200 µL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-04 1 mL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Rat Monocyte differentiation antigen CD14 (CD14) ELISA Kit
MBS2803256-01 48 Tests

Rat Monocyte differentiation antigen CD14 (CD14) ELISA Kit

Sign In for Pricing
View Details