Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 5 (FGF5)

This Recombinant Human Fibroblast growth factor 5 (FGF5) spans the amino acid sequence from region 21-268aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-5) (Heparin-binding growth factor 5) (HBGF-5) (Smag-82)

UniProt

P12034

Expression Region

21-268aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-C-RAF  (Ser259)  Antibody
ABF3064 100 µg

Phospho-C-RAF (Ser259) Antibody

Sign In for Pricing
View Details
Human Dynein heavy chain (DNAH9) activation kit by CRISPRa
GA101231 1 Kit

Human Dynein heavy chain (DNAH9) activation kit by CRISPRa

Sign In for Pricing
View Details
GAPDHP44 ORF Vector (Human) (pORF)
21278011 1.0 µg DNA

GAPDHP44 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPS4XP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV782261 1.0 µg DNA

RPS4XP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-WBP2 Antibody
MBS8325101-01 0.03 mL

Anti-WBP2 Antibody

Sign In for Pricing
View Details
Anti-WBP2 Antibody
MBS8325101-02 0.05 mL

Anti-WBP2 Antibody

Sign In for Pricing
View Details