Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 15 (Gdf15)

This Recombinant Mouse Growth/differentiation factor 15 (Gdf15) spans the amino acid sequence from region 189-303aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1)

UniProt

Q9Z0J7

Expression Region

189-303aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD369/CLEC7A Protein, C-His
AP96047 50 µg

Recombinant Human CD369/CLEC7A Protein, C-His

Sign In for Pricing
View Details
WDR5 siRNA (Mouse)
CRN1304-01 15 nmol

WDR5 siRNA (Mouse)

Sign In for Pricing
View Details
WDR5 siRNA (Mouse)
CRN1304-02 30 nmol

WDR5 siRNA (Mouse)

Sign In for Pricing
View Details
MEC (CCL28, C-C Motif Chemokine 28, Mucosae-associated Epithelial Chemokine, Protein CCK1, Small-inducible Cytokine A28, SCYA28, MGC71902) (Biotin) discontinued
143652-01 25 µg

MEC (CCL28, C-C Motif Chemokine 28, Mucosae-associated Epithelial Chemokine, Protein CCK1, Small-inducible Cytokine A28, SCYA28, MGC71902) (Biotin) discontinued

Sign In for Pricing
View Details
MEC (CCL28, C-C Motif Chemokine 28, Mucosae-associated Epithelial Chemokine, Protein CCK1, Small-inducible Cytokine A28, SCYA28, MGC71902) (Biotin) discontinued
143652-02 50 µg

MEC (CCL28, C-C Motif Chemokine 28, Mucosae-associated Epithelial Chemokine, Protein CCK1, Small-inducible Cytokine A28, SCYA28, MGC71902) (Biotin) discontinued

Sign In for Pricing
View Details
CASIN 10mM * 1mL in DMSO
A12912-10mM-D 10 mM x 1mL in DMSO

CASIN 10mM * 1mL in DMSO

Sign In for Pricing
View Details