Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synapsin-1 (Syn1), partial

This Recombinant Rat Synapsin-1 (Syn1), partial spans the amino acid sequence from region 113-420aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Synapsin I)

UniProt

P09951

Expression Region

113-420aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiamine Hydrochloride
B2017571 10 g

Thiamine Hydrochloride

Sign In for Pricing
View Details
5-Chloro-2- (methoxymethoxy) phenylboronic acid
436005-01 25 mg

5-Chloro-2- (methoxymethoxy) phenylboronic acid

Sign In for Pricing
View Details
5-Chloro-2- (methoxymethoxy) phenylboronic acid
436005-02 50 mg

5-Chloro-2- (methoxymethoxy) phenylboronic acid

Sign In for Pricing
View Details
Western Primary Antibody Dilution Buffer
EZWB06-1-100mL 100 mL

Western Primary Antibody Dilution Buffer

Sign In for Pricing
View Details
Glucagon, CT (GCG, Glicentin-related Polypeptide, GRPP) (HRP) discontinued
G2040-01R-HRP 200 µL

Glucagon, CT (GCG, Glicentin-related Polypeptide, GRPP) (HRP) discontinued

Sign In for Pricing
View Details
Human PMCH Protein Lysate 20ug
IHUPMCHPLLY20UG 20 µg

Human PMCH Protein Lysate 20ug

Sign In for Pricing
View Details