Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group protein B1 (HMGB1), partial

This Recombinant Human High mobility group protein B1 (HMGB1), partial spans the amino acid sequence from region 8-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(High mobility group protein 1) (HMG-1)

UniProt

P09429

Expression Region

8-179aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfat (NM_198644) Mouse Tagged ORF Clone
MG211817 10 µg

Zfat (NM_198644) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Whrn Protein Vector (Mouse) (pPM-C-HA)
PV247416 500 ng

Whrn Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Cullin 2 Antibody
MBS9239313-01 0.05 mL

Anti-Cullin 2 Antibody

Sign In for Pricing
View Details
Anti-Cullin 2 Antibody
MBS9239313-02 0.1 mL

Anti-Cullin 2 Antibody

Sign In for Pricing
View Details
Anti-Cullin 2 Antibody
MBS9239313-03 5x 0.1 mL

Anti-Cullin 2 Antibody

Sign In for Pricing
View Details
Recombinant Human G-CSF (CSF3)
Z100245 10 µg

Recombinant Human G-CSF (CSF3)

Sign In for Pricing
View Details