Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group protein B1 (HMGB1), partial

This Recombinant Human High mobility group protein B1 (HMGB1), partial spans the amino acid sequence from region 8-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(High mobility group protein 1) (HMG-1)

UniProt

P09429

Expression Region

8-179aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SST (SMST, somatostatin-28, Growth hormone release-inhibiting factor) discontinued
145220 100 µg

SST (SMST, somatostatin-28, Growth hormone release-inhibiting factor) discontinued

Sign In for Pricing
View Details
PNO1 (NM_020143) Human Tagged ORF Clone
RC203434 10 µg

PNO1 (NM_020143) Human Tagged ORF Clone

Sign In for Pricing
View Details
amelotin Lentiviral Activation Particles (h)
sc-418008-LAC 200 µL

amelotin Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TADA3L (TADA3) (NM_001278270) Human Tagged ORF Clone
RG238192 10 µg

TADA3L (TADA3) (NM_001278270) Human Tagged ORF Clone

Sign In for Pricing
View Details
WNK3 Antibody (HRP)
orb516137-01 50 µg

WNK3 Antibody (HRP)

Sign In for Pricing
View Details
WNK3 Antibody (HRP)
orb516137-02 100 µg

WNK3 Antibody (HRP)

Sign In for Pricing
View Details