Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cannabinoid receptor 2 (Cnr2)

This Recombinant Mouse Cannabinoid receptor 2 (Cnr2) spans the amino acid sequence from region 1-347aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CB-2; CB2; mCB2

UniProt

P47936

Expression Region

1-347aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPON1 Protein Vector (Mouse) (pPB-C-His)
PV233582 500 ng

SPON1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Amd1 (NM_009665) Mouse Tagged ORF Clone Lentiviral Particle
MR204954L3V 200 µL

Amd1 (NM_009665) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human CD101 Knockout HEK293T cell line
GTR15414626 1 Vial

Human CD101 Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)
MBS1172043-01 0.02 mg (E-Coli)

Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)
MBS1172043-02 0.1 mg (E-Coli)

Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)
MBS1172043-03 0.02 mg (Yeast)

Recombinant Desulfococcus oleovorans Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details