Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A, R130S) (Active)

This Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A, R130S) (Active) spans the amino acid sequence from region 29-159aa (R127A, R130S) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymic stromal lymphopoietin; TSLP

UniProt

A0A7N9CAT7

Expression Region

29-159aa (R127A, R130S)

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP (R127A, R130S) at 2 μg/ml can bind Anti-TSLP recombinant antibody. The EC50 is 45.77-53.37 ng/mL. 2Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime) .

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-100 1x 100 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BMI1 (Oncogene and Stem Cell Marker) (BMI1/2823), CF640R conjugate, 0.1mg/mL
BNC402823-100 1x 100 µL

BMI1 (Oncogene and Stem Cell Marker) (BMI1/2823), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details