Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chondroitin sulfate proteoglycan 4 (Cspg4), partial

This Recombinant Rat Chondroitin sulfate proteoglycan 4 (Cspg4), partial spans the amino acid sequence from region 575-1044aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan NG2; HSN tumor-specific antigen

UniProt

Q00657

Expression Region

575-1044aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPEIFQAYDPDSACEGLTIQLLGVSASVPVEHRDQPGEPVTEFSCRDLEAGNIVYVHRGGPAQDLTFRVSDGMQASGPATLKVVAVRPAIQILHNTGLRLAQGSAAAILPANLSVETNAVGQDVSVLFRVTGTLQFGELQKQGAGGVEGTEWWDTLAFHQRDVEQGRVRYLSTDPQHHTQDTVEDLTLEVQVGQETLSNLSFPVTIQRATVWMLQLEPLHTQNPHQETLTSAHLEASLEEEGEGGPYPHIFHYELVQAPRRGNLLLQGTRLSDGQSFSQSDLQAGRVTYRATTRTSEAAEDSFRFRVTSPPHFSPLYTFPIHIGGDPNAPVLTNVLLMVPEGGEGVLSADHLFVKSLNSASYLYEVMEQPHHGSLAWRDPKGRATPVTSFTNEDLLHGRLVYQHDDSETIEDDIPFVATRQGEGSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRVFHVARGGQRLLTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA5 Protein Vector (Rat) (pPM-C-His)
PV271789 500 ng

GSTA5 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-dsRNA antibody (Mouse IgM) (Detector)
DD3412-03 200 µL

Anti-dsRNA antibody (Mouse IgM) (Detector)

Sign In for Pricing
View Details
Mouse B4galt6 (NM_019737) AAV Particle
MR205973A1V 250 µL

Mouse B4galt6 (NM_019737) AAV Particle

Sign In for Pricing
View Details
Recombinant Human Rab GDP dissociation inhibitor beta Protein, GST, E.coli-200ug
QP8339-ec-200ug 200ug

Recombinant Human Rab GDP dissociation inhibitor beta Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2004476-01 0.1 mL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)
MBS2004476-02 0.2 mL

Polyclonal Antibody to Heat Shock 70kDa Protein 5 (HSPA5)

Sign In for Pricing
View Details