Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin A (LBA)

This Recombinant Glycine max Leghemoglobin A (LBA) spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nodulin-2; N-2

UniProt

P02238

Expression Region

2-144aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TAGLN3 qPCR Primer Pair
QH39249S 200 Tests

Human TAGLN3 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human ARPC3 sgRNA gene knockout kit - Lentiviral human ARPC3 sgRNA gene knockout kit (100)
GTR15361525 1 Vial

Lentiviral human ARPC3 sgRNA gene knockout kit - Lentiviral human ARPC3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Ethyl 4-oxo-3H-phthalazin-1-ylacetate
TYD-00957-01 10 mg

Ethyl 4-oxo-3H-phthalazin-1-ylacetate

Sign In for Pricing
View Details
Ethyl 4-oxo-3H-phthalazin-1-ylacetate
TYD-00957-02 25 mg

Ethyl 4-oxo-3H-phthalazin-1-ylacetate

Sign In for Pricing
View Details
Ethyl 4-oxo-3H-phthalazin-1-ylacetate
TYD-00957-03 50 mg

Ethyl 4-oxo-3H-phthalazin-1-ylacetate

Sign In for Pricing
View Details
Spectrum Tube Holder
1130095 1 Each

Spectrum Tube Holder

Sign In for Pricing
View Details