Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin A (LBA)

This Recombinant Glycine max Leghemoglobin A (LBA) spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nodulin-2; N-2

UniProt

P02238

Expression Region

2-144aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tjp3 sgRNA CRISPR Lentivector set (Rat)
K6110101 3x 1.0 µg

Tjp3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Hsa-miR-4280 miRNA Inhibitor
orb1872435-01 10 nmol

Hsa-miR-4280 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4280 miRNA Inhibitor
orb1872435-02 20 nmol

Hsa-miR-4280 miRNA Inhibitor

Sign In for Pricing
View Details
5430437P03Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10794124 3x 1.0µg DNA

5430437P03Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TMEM205 (Transmembrane Protein 205, UNQ501, MBC3205) discontinued
215847 50 µg

TMEM205 (Transmembrane Protein 205, UNQ501, MBC3205) discontinued

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)
orb2658620-01 20 µg

Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

Sign In for Pricing
View Details