Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7)

This Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7) spans the amino acid sequence from region 1-285aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTG1-binding factor 1; CCR4-associated factor 1; CAF-1; Caf1a

UniProt

Q9UIV1

Expression Region

1-285aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF697 cDNA Clone
MBS1268497-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZNF697 cDNA Clone

Sign In for Pricing
View Details
ZNF697 cDNA Clone
MBS1268497-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZNF697 cDNA Clone

Sign In for Pricing
View Details
HDAC11 antibody (pAb)
MBS388406-01 0.2 mL

HDAC11 antibody (pAb)

Sign In for Pricing
View Details
HDAC11 antibody (pAb)
MBS388406-02 5x 0.2 mL

HDAC11 antibody (pAb)

Sign In for Pricing
View Details
C19orf21 Polyclonal Antibody, PE Conjugated
bs-9678R-PE 100 µL

C19orf21 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
TIFA Rabbit Polyclonal Antibody (BF555)
orb1599035 100 µL

TIFA Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details