Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei L-lactate dehydrogenase (ldh)

This Recombinant Lactobacillus casei L-lactate dehydrogenase (ldh) spans the amino acid sequence from region 2-326aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-LDH

UniProt

P00343

Expression Region

2-326aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Lactobacillus casei

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASITDKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKNDIETRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A1 Adenovirus (Rat)
44270056 1.0 mL

SLC7A1 Adenovirus (Rat)

Sign In for Pricing
View Details
Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit
MBS2503312-01 24 Tests

Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit

Sign In for Pricing
View Details
Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit
MBS2503312-02 48 Tests

Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit

Sign In for Pricing
View Details
Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit
MBS2503312-03 96 Tests

Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit

Sign In for Pricing
View Details
Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit
MBS2503312-04 5x 96 Tests

Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit

Sign In for Pricing
View Details
Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit
MBS2503312-05 10x 96 Tests

Monkey DPP6 (Dipeptidyl Peptidase VI) ELISA Kit

Sign In for Pricing
View Details