Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Protein Rv1269c (Rv1269c)

This Recombinant Mycobacterium tuberculosis Protein Rv1269c (Rv1269c) spans the amino acid sequence from region 36-124aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WM45

Expression Region

36-124aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl 2-Acetamido-3,4,6-tri-O-benzyl-2-deoxy-alpha-D-glucopyranoside
TRC-B222860-500MG 500 mg

Benzyl 2-Acetamido-3,4,6-tri-O-benzyl-2-deoxy-alpha-D-glucopyranoside

Sign In for Pricing
View Details
1- (2-chloro-4-fluorophenyl) cyclopentanol
PC1019018-01 250 mg

1- (2-chloro-4-fluorophenyl) cyclopentanol

Sign In for Pricing
View Details
1- (2-chloro-4-fluorophenyl) cyclopentanol
PC1019018-02 500 mg

1- (2-chloro-4-fluorophenyl) cyclopentanol

Sign In for Pricing
View Details
1- (2-chloro-4-fluorophenyl) cyclopentanol
PC1019018-03 1 g

1- (2-chloro-4-fluorophenyl) cyclopentanol

Sign In for Pricing
View Details
1- (2-chloro-4-fluorophenyl) cyclopentanol
PC1019018-04 5 g

1- (2-chloro-4-fluorophenyl) cyclopentanol

Sign In for Pricing
View Details
Fastk (NM_001011967) Rat Tagged Lenti ORF Clone
RR208876L4 10 µg

Fastk (NM_001011967) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details