Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Insulin-like growth factor I (IGF1)

This Recombinant Chicken Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 49-118aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P18254

Expression Region

49-118aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Disco-interacting protein 2 homolog A (DIP2A) ELISA Kit
AE47224HU-01 48 Tests

Human Disco-interacting protein 2 homolog A (DIP2A) ELISA Kit

Sign In for Pricing
View Details
Human Disco-interacting protein 2 homolog A (DIP2A) ELISA Kit
AE47224HU-02 96 Tests

Human Disco-interacting protein 2 homolog A (DIP2A) ELISA Kit

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF594 conjugate, 0.1mg/mL
BNC941974-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Chloro-D-beta-homophenylalanine hydrochloride
269777-01 50 mg

2-Chloro-D-beta-homophenylalanine hydrochloride

Sign In for Pricing
View Details
2-Chloro-D-beta-homophenylalanine hydrochloride
269777-02 100 mg

2-Chloro-D-beta-homophenylalanine hydrochloride

Sign In for Pricing
View Details
2-Chloro-D-beta-homophenylalanine hydrochloride
269777-03 250 mg

2-Chloro-D-beta-homophenylalanine hydrochloride

Sign In for Pricing
View Details