Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CMRF35-like molecule 6 (Cd300c), partial

This Recombinant Mouse CMRF35-like molecule 6 (Cd300c), partial spans the amino acid sequence from region 22-188aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLM-6; CD300 antigen-like family member C; CD antigen CD300c

UniProt

A2A7V7

Expression Region

22-188aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin)
MBS6144503-01 0.1 mL

SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin)

Sign In for Pricing
View Details
SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin)
MBS6144503-02 5x 0.1 mL

SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin)

Sign In for Pricing
View Details
ECAT1 Lentiviral Activation Particles (h)
sc-414750-LAC 200 µL

ECAT1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
20-hydroxycholesterol
080-62A 5 mg

20-hydroxycholesterol

Sign In for Pricing
View Details
RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (HRP)
132253-HRP 100 µL

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (HRP)

Sign In for Pricing
View Details
T-complex Protein 1 eta (T-complex Protein 1 eta Subunit, TCP1 eta, TCP1-eta, TCP-1 eta, Chaperonin Containing TCP1 eta, Chaperonin-containing TCP-1 eta, CCT eta, CCT-eta, CCTH, Chaperonin Containing TCP1 Subunit 7, Chaperonin-containing TCP-1 Subunit 7,
MBS6269177-01 0.1 mL

T-complex Protein 1 eta (T-complex Protein 1 eta Subunit, TCP1 eta, TCP1-eta, TCP-1 eta, Chaperonin Containing TCP1 eta, Chaperonin-containing TCP-1 eta, CCT eta, CCT-eta, CCTH, Chaperonin Containing TCP1 Subunit 7, Chaperonin-containing TCP-1 Subunit 7,

Sign In for Pricing
View Details