Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum C phage Hemagglutinin components HA-70 type C (HA-70)

This Recombinant Clostridium botulinum C phage Hemagglutinin components HA-70 type C (HA-70) spans the amino acid sequence from region 7-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HA3; Hemagglutinin components HA-22/23/53 type C; Hemagglutinin components HA-22/23/53 type C1; HA3b

UniProt

P46085

Expression Region

7-192aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium botulinum C phage (Clostridium botulinum C bacteriophage)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELYYTKDKSINNVNLADGNYVVNRGDGWILSRQNQNLGGNISNNGCTAIVGDLRIRETATPYYYPTASFNEEYIKNNVQNVFANFTEASEIPIGFEFSKTAPSNKSLYMYLQYTYIRYEIIKVLQNTVTERAVLYVPSLGYVKSIEFNSEEQIDKNFYFTSQDKCILNEKFIYKKIDDTITVKESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL
BNC471855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL
BNC680811-100 1x 100 µL

ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL
BNC470741-100 1x 100 µL

Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL
BNC401857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details