Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Myoglobin (MB)

This Recombinant Dog Myoglobin (MB) spans the amino acid sequence from region 2-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P63113

Expression Region

2-154aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-10
EPT173 10 µg

Recombinant Mouse IL-10

Sign In for Pricing
View Details
ARMCX1 Protein Vector (Human) (pPB-His-GST)
PV323847 500 ng

ARMCX1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Vps45 Rat shRNA Plasmid (Locus ID 64516)
TR713297 1 Kit

Vps45 Rat shRNA Plasmid (Locus ID 64516)

Sign In for Pricing
View Details
Chicken GC ELISA Kit
ECKG0108 96 Tests

Chicken GC ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal NOS1AP Antibody (3B11)
H00009722-M02 0.1 mg

Mouse Monoclonal NOS1AP Antibody (3B11)

Sign In for Pricing
View Details
Hsa-miR-320c agomir
HY-R00674A-01 5 nmol

Hsa-miR-320c agomir

Sign In for Pricing
View Details