Recombinant Human Metal cation symporter ZIP14 (SLC39A14), partial
This Recombinant Human Metal cation symporter ZIP14 (SLC39A14), partial spans the amino acid sequence from region 31-157aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
LIV-1 subfamily of ZIP zinc transporter 4; LZT-Hs4; Solute carrier family 39 member 14; Zrt- and Irt-like protein 14; ZIP-14
UniProt
Q15043
Expression Region
31-157aa
Tag
C-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4091903 1.0 µg DNA
Spsb3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
K7475005 3x 1.0 µg
Sh3glb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details