Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon alpha-1/13 (IFNA1)

This Recombinant Human Interferon alpha-1/13 (IFNA1) spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon alpha-D ; LeIF D

UniProt

P01562

Expression Region

24-189aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallus TGF beta 1 ELISA Kit (Ready to Use)
orb549461-01 48 Tests

Gallus TGF beta 1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Gallus TGF beta 1 ELISA Kit (Ready to Use)
orb549461-02 96 Tests

Gallus TGF beta 1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse Cfap61 activation kit by CRISPRa
GA211029 1 Kit

Mouse Cfap61 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Immunoglobulin G (IgG) AssayLite™ Antibody (FITC Conjugate)
24104-05041 2x 75 µg

Human Immunoglobulin G (IgG) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Rat Monoclonal CCR1 Antibody (643854R) [mFluor Violet 450 SE]
FAB5986RMFV450 0.1 mL

Rat Monoclonal CCR1 Antibody (643854R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Nptx2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6714203 1.0 µg DNA

Nptx2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details