Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein, intestinal (FABP2)

This Recombinant Human Fatty acid-binding protein, intestinal (FABP2) spans the amino acid sequence from region 2-132aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein 2; Intestinal-type fatty acid-binding protein; I-FABP

UniProt

P12104

Expression Region

2-132aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LBX1 Adenovirus (Rat)
26334056 1.0 mL

LBX1 Adenovirus (Rat)

Sign In for Pricing
View Details
ZC3HC1 (Nuclear-Interacting Partner of ALK, Nuclear-Interacting Partner of Anaplastic Lymphoma Kinase, hNIPA, Zinc Finger C3HC-Type Protein 1, NIPA, HSPC216)
407328-01 50 µL

ZC3HC1 (Nuclear-Interacting Partner of ALK, Nuclear-Interacting Partner of Anaplastic Lymphoma Kinase, hNIPA, Zinc Finger C3HC-Type Protein 1, NIPA, HSPC216)

Sign In for Pricing
View Details
ZC3HC1 (Nuclear-Interacting Partner of ALK, Nuclear-Interacting Partner of Anaplastic Lymphoma Kinase, hNIPA, Zinc Finger C3HC-Type Protein 1, NIPA, HSPC216)
407328-02 100 µL

ZC3HC1 (Nuclear-Interacting Partner of ALK, Nuclear-Interacting Partner of Anaplastic Lymphoma Kinase, hNIPA, Zinc Finger C3HC-Type Protein 1, NIPA, HSPC216)

Sign In for Pricing
View Details
TMEM56 Polyclonal Antibody
A63652-020 20 µL

TMEM56 Polyclonal Antibody

Sign In for Pricing
View Details
(3aS, 4aR) -1,3-Dibenzyldihydro-1H-selenolo[3,4-d]imidazole-2,4- (3H,3aH) dione
D3480-95B 5 mg

(3aS, 4aR) -1,3-Dibenzyldihydro-1H-selenolo[3,4-d]imidazole-2,4- (3H,3aH) dione

Sign In for Pricing
View Details
Rat Calcitonin ELISA Kit (CT)
RK03596 96 Tests

Rat Calcitonin ELISA Kit (CT)

Sign In for Pricing
View Details