Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon (Gcg), partial

This Recombinant Mouse Glucagon (Gcg), partial spans the amino acid sequence from region 21-89aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GRPP; OXM; OXY; GLP-1;7-37; GLP-17-37;7-36; GLP-17-36; GLP-2

UniProt

P55095

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Iqcn Pre-designed siRNA Set A
SI206840A 1 Each

Rat Iqcn Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Peptide Yy (PYY) Monoclonal antibody
FY-AB36368-01 1 mL

Anti-Peptide Yy (PYY) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Peptide Yy (PYY) Monoclonal antibody
FY-AB36368-02 100 µL

Anti-Peptide Yy (PYY) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Peptide Yy (PYY) Monoclonal antibody
FY-AB36368-03 200 µL

Anti-Peptide Yy (PYY) Monoclonal antibody

Sign In for Pricing
View Details
Anti-RECK Antibody Picoband®
A06439-3 100 µg/Vial

Anti-RECK Antibody Picoband®

Sign In for Pricing
View Details
IKA Trayster Digital
MIX1008 1 Each

IKA Trayster Digital

Sign In for Pricing
View Details