Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon (Gcg), partial

This Recombinant Mouse Glucagon (Gcg), partial spans the amino acid sequence from region 21-89aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GRPP; OXM; OXY; GLP-1;7-37; GLP-17-37;7-36; GLP-17-36; GLP-2

UniProt

P55095

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc8 Mouse shRNA Lentiviral Particle (Locus ID 277343)
TL517709V 500 µL Each

Wfdc8 Mouse shRNA Lentiviral Particle (Locus ID 277343)

Sign In for Pricing
View Details
Anti-TEFF1 TMEFF1 Antibody
A10268 100 µL

Anti-TEFF1 TMEFF1 Antibody

Sign In for Pricing
View Details
NOV (Nephroblastoma Overexpressed Gene, CCN3, IGFBP9) (Biotin)
249410-Biotin 100 µL

NOV (Nephroblastoma Overexpressed Gene, CCN3, IGFBP9) (Biotin)

Sign In for Pricing
View Details
HCG22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0936907 1.0 µg DNA

HCG22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Goat IgG
M1102-100 100 µg

Goat IgG

Sign In for Pricing
View Details
MTAP Antibody
ABD6197 100 µg

MTAP Antibody

Sign In for Pricing
View Details