Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

This Recombinant Staphylococcus aureus Alpha-hemolysin (hly) spans the amino acid sequence from region 27-319aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-toxin

UniProt

Q2G1X0

Expression Region

27-319aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain NCTC 8325 / PS 47)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 405) discontinued
T8180-04-ML405 100 µL

TRAIL (TNF-Related Apoptosis Inducing Ligand, Apo2 Ligand) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Oxytroflavoside A
M32439-01 100 mg

Oxytroflavoside A

Sign In for Pricing
View Details
Oxytroflavoside A
M32439-02 50 mg

Oxytroflavoside A

Sign In for Pricing
View Details
Oxytroflavoside A
M32439-03 500 mg

Oxytroflavoside A

Sign In for Pricing
View Details
Oxytroflavoside A
M32439-04 Inquire

Oxytroflavoside A

Sign In for Pricing
View Details
Oxytroflavoside A
M32439-05 5 mg

Oxytroflavoside A

Sign In for Pricing
View Details