Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB), partial

This Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB), partial spans the amino acid sequence from region 27-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP-Ib beta; GPIb-beta; GPIbB; Antigen CD42b-beta; CD antigen CD42c

UniProt

P13224

Expression Region

27-147aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HighQC™ RFP-Human Umbilical Cord-Derived Mesenchymal Stem Cell
ABC-FC0048 1 Vial

HighQC™ RFP-Human Umbilical Cord-Derived Mesenchymal Stem Cell

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit
CK-bio-11134-01 48 Tests

Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit
CK-bio-11134-02 96 Tests

Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit
CK-bio-11134-03 5x 96 Tests

Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit
CK-bio-11134-04 10x 96 Tests

Human cysteinyl aspartate specific proteinases 12, CASP12 ELISA Kit

Sign In for Pricing
View Details
5′ DY-480XL / 3′ BHQ-2® (20 to 29 nmol)
JBS-FP-194-20 20 nmol

5′ DY-480XL / 3′ BHQ-2® (20 to 29 nmol)

Sign In for Pricing
View Details