Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Barrier-to-autointegration factor (baf)

This Recombinant Drosophila melanogaster Barrier-to-autointegration factor (baf) spans the amino acid sequence from region 1-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9VLU0

Expression Region

1-90aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Drosophila melanogaster (Fruit fly)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINA10 (NM_016186) Human Recombinant Protein
TP304642L 1 mg

SERPINA10 (NM_016186) Human Recombinant Protein

Sign In for Pricing
View Details
Integrin beta 7 (ITGB7) Rabbit Polyclonal Antibody
TA372785 100 µL

Integrin beta 7 (ITGB7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FastClick™ 5-FAM Alkyne
72860-AAT 1 mg

FastClick™ 5-FAM Alkyne

Sign In for Pricing
View Details
CD8A (NM_001145873) Human Over-expression Lysate
LY429040 100 µg

CD8A (NM_001145873) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp300 Mouse Gene Knockout Kit (CRISPR)
KN519781 1 Kit

Zfp300 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lymphocytes Rabbit Polyclonal Antibody
AP31645SU-L 5 mL

Lymphocytes Rabbit Polyclonal Antibody

Sign In for Pricing
View Details