Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stabilin-1 (Stab1), partial

This Recombinant Mouse Stabilin-1 (Stab1), partial spans the amino acid sequence from region 1604-1703aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1; FEEL-1

UniProt

Q8R4Y4

Expression Region

1604-1703aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEYKELKGDGPFTVFVPHADLISNMSQDELARIRAHRQLVFRYHVVGCRKLWSQEMLDQGYITTLSGHTLRVSEREGSIYLNDFARVVSSDLEVVNGVLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHTF1 Rabbit Polyclonal Antibody
BT-AP11928-01 20 µL

PHTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHTF1 Rabbit Polyclonal Antibody
BT-AP11928-02 50 µL

PHTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHTF1 Rabbit Polyclonal Antibody
BT-AP11928-03 100 µL

PHTF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype V Glycine--tRNA ligase beta subunit (glyS), partial
MBS1452785 Inquire

Recombinant Streptococcus agalactiae serotype V Glycine--tRNA ligase beta subunit (glyS), partial

Sign In for Pricing
View Details
MED28 Antibody
orb2680236-01 50 µL

MED28 Antibody

Sign In for Pricing
View Details
MED28 Antibody
orb2680236-02 100 µL

MED28 Antibody

Sign In for Pricing
View Details