Recombinant Sigmodon hispidus Interferon gamma (IFNG)
This Recombinant Sigmodon hispidus Interferon gamma (IFNG) spans the amino acid sequence from region 21-170aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IFN-gamma
UniProt
Q9QXX2
Expression Region
21-170aa
Tag
C-terminal 6xHis-tagged
Source
Yeast
Origin
Sigmodon hispidus (Hispid cotton rat)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
HFTVIEEIEKLKKYFNSSSSDVGDQKDIVSDILRNWQNDRDVKVIESQIVSFYLKLFEALKEHKTIQESINTIRADLIVNFFNNSREKMDDFIKLTTIPVNDLQVQRKAVNELVGVMHRLSSNIRRKKKGSRCCFGGGDRLNQNYPARSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031995 200 µL
APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amyloid protein 40, Beta-APP40, C83, P3 (42), P3 (40), C80, Gamma-secretase C-terminal fragment 59, Amyloid intracellular domain 59, Gamma-CTF (59), Gamma-secretase C-terminal fragment 57, Amyloid intracellular domain 57, Gamma-CTF (57), Gamma-secretase C-terminal fragment 50, Amyloid intracellular domain 50, Gamma-CTF (50), C31)
Sign In for Pricing
View Details 