Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sigmodon hispidus Interferon gamma (IFNG)

This Recombinant Sigmodon hispidus Interferon gamma (IFNG) spans the amino acid sequence from region 21-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma

UniProt

Q9QXX2

Expression Region

21-170aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Sigmodon hispidus (Hispid cotton rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFTVIEEIEKLKKYFNSSSSDVGDQKDIVSDILRNWQNDRDVKVIESQIVSFYLKLFEALKEHKTIQESINTIRADLIVNFFNNSREKMDDFIKLTTIPVNDLQVQRKAVNELVGVMHRLSSNIRRKKKGSRCCFGGGDRLNQNYPARSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930562C15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3553606 1.0 µg DNA

4930562C15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ESD siRNA (m)
sc-144943 10 µM

ESD siRNA (m)

Sign In for Pricing
View Details
Human IgG Fc Fragment Antibody
E55A11157 100 µL

Human IgG Fc Fragment Antibody

Sign In for Pricing
View Details
SEC14L2 Polyclonal Antibody
MBS9131074-01 0.02 mL

SEC14L2 Polyclonal Antibody

Sign In for Pricing
View Details
SEC14L2 Polyclonal Antibody
MBS9131074-02 0.1 mL

SEC14L2 Polyclonal Antibody

Sign In for Pricing
View Details
SEC14L2 Polyclonal Antibody
MBS9131074-03 5x 0.1 mL

SEC14L2 Polyclonal Antibody

Sign In for Pricing
View Details