Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon alpha-2 (Ifna2)

This Recombinant Mouse Interferon alpha-2 (Ifna2) spans the amino acid sequence from region 24-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-alpha-2

UniProt

P01573

Expression Region

24-190aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLTM CRISPR Activation Plasmid (m)
sc-426135-ACT 20 µg

SLTM CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CBR3 Antibody
E046412 100 µg -100 µL

CBR3 Antibody

Sign In for Pricing
View Details
UNC5C (unc-5 homolog C, Netrin receptor UNC5C precursor, UNC5H3, Unc-5 homolog 3, Unc-5 homolog C) (APC) discontinued
U0893-50A-APC 200 µL

UNC5C (unc-5 homolog C, Netrin receptor UNC5C precursor, UNC5H3, Unc-5 homolog 3, Unc-5 homolog C) (APC) discontinued

Sign In for Pricing
View Details
Canagliflozin
TRC-C175190-5MG 5 mg

Canagliflozin

Sign In for Pricing
View Details
RWDD3-set siRNA/shRNA/RNAi Lentivector (Human)
42905091 4x 500 ng

RWDD3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
hsa-miR-3620 Primers
MPH01478 150 µL - 10 µM

hsa-miR-3620 Primers

Sign In for Pricing
View Details