What is the catalog number for Leptin, Human?

The catalog number for Leptin, Human is HY-P7232.

What sizes are available for Leptin, Human?

Leptin, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does Leptin, Human come in?

Leptin, Human is available in 4 different pack sizes.

Is Leptin, Human in stock?

Leptin, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Leptin, Human?

Leptin, Human is manufactured by QuantiMol.

What is the estimated delivery time for Leptin, Human?

Estimated delivery time for Leptin, Human is approximately 15 business day(s), depending on your location.

Leptin, Human

Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human is a recombinant human Leptin protein expressed by E. coli without a tag.

Product Specifications

Product Name Alternative

Leptin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-human.html

Purity

98.00

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Molecular Formula

3952 (Gene_ID) P41159 (V22-C167) (Accession)

Molecular Weight

Approximately 13-16 kDa

References & Citations

[1]Chen K, et al. Induction of leptin resistance through direct interaction of C-reactive protein with leptin. Nat Med. 2006 Apr;12 (4) :425-32.|[2]Tsuchiya T, et al. Expression of leptin receptor in lung: leptin as a growth factor. Eur J Pharmacol. 1999 Jan 22;365 (2-3) :273-9.|[3]Lin YC, et al. Leptin decreases heart rate associated with increased ventricular repolarization via its receptor. Am J Physiol Heart Circ Physiol. 2015 Nov 15;309 (10) :H1731-9.|[4]Brzozowski T, et al. Brain-gut axis in gastroprotection by leptin and cholecystokinin against ischemia-reperfusion induced gastric lesions. J Physiol Pharmacol. 2001 Dec;52 (4 Pt 1) :583-602.