Leptin, Human
Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human is a recombinant human Leptin protein expressed by E. coli without a tag.
Product Specifications
Product Name Alternative
Leptin Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/leptin-protein-human.html
Purity
98.00
Smiles
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Molecular Formula
3952 (Gene_ID) P41159 (V22-C167) (Accession)
Molecular Weight
Approximately 13-16 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Human / Mouse EDAR Recombinant Protein Fc Tag Lyophilized 50UG
