Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)
This Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active) spans the amino acid sequence from region 1-84aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RU2AS
UniProt
Q9UBP8
Expression Region
1-84aa
Tag
C-terminal 10xHis-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Kidney & Urological Research
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody. The EC50 is 4.924-6.034 ng/mL.
Form
Lyophilized powder
Molecular Weight
10.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1245892 Inquire
Recombinant Drosophila erecta Eukaryotic translation initiation factor 3 subunit A (eIF3-S10), partial
Sign In for Pricing
View Details orb3010698-01 20 µg
Recombinant Human cTAGE family member 15 (CTGEF), partial
Sign In for Pricing
View Details orb3010698-02 100 µg
Recombinant Human cTAGE family member 15 (CTGEF), partial
Sign In for Pricing
View Details orb3010698-03 1 mg
Recombinant Human cTAGE family member 15 (CTGEF), partial
Sign In for Pricing
View Details 