Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)

This Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active) spans the amino acid sequence from region 1-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RU2AS

UniProt

Q9UBP8

Expression Region

1-84aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Kidney & Urological Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody. The EC50 is 2.040-2.284 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuro-DiO in vegetable oil
#60019 1x 200 µL

Neuro-DiO in vegetable oil

Sign In for Pricing
View Details
alpha-Amino-2-hydroxybenzeneacetic Acid
TRC-A580015-500MG 500 mg

alpha-Amino-2-hydroxybenzeneacetic Acid

Sign In for Pricing
View Details
TRIM37 Human Gene Knockout Kit (CRISPR)
KN205948 1 Kit

TRIM37 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH3PXD2B (NM_001017995) Human Over-expression Lysate
LC422232 20 µg

SH3PXD2B (NM_001017995) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Glypican 1 / GPC1 (S486A, S488A, S490A) Protein, His Tag (MALS verified)
GP1-H52H8-100ug 100 µg

Human Glypican 1 / GPC1 (S486A, S488A, S490A) Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
NR2C1 (NM_001032287) Human Over-expression Lysate
LY422297 100 µg

NR2C1 (NM_001032287) Human Over-expression Lysate

Sign In for Pricing
View Details