Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
This Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active) spans the amino acid sequence from region 22-138aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
P48546
Expression Region
22-138aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Gastroenterology & Hepatology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody. The EC50 is 16.18-18.70 ng/mL.
Form
Lyophilized powder
Molecular Weight
16.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-7653R-BF680 100 µL
DNase gamma Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details