Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial

This Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial spans the amino acid sequence from region 20-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GB

UniProt

P36320

Expression Region

20-399aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IYCDSDDYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKNELTFPTSYRDVGVVYFLDRTVMGLAMPVYEANLVNSRAQCYSAVAIKRPDGTVFSAYHEDNNKNETLELFPLNFKSVTNKRFITTKEPYFARGPLWLYSTSTSLNCIVTEATAKAKYPFSYFALTTGEIVEGSPFFDGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKGDTLFSWEIKEENESVCMLKHWTTVTHGLRAETDETYHFISKELTAAFVASKESLNLTDPKQTCIKNEFEKIITDVYMSDYNDAYSMNGSYQIFKTTGDLILIWQPLVQKSLMVLEQGSVNLRRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKAG00090-96W - KC ELISA Kit (Mouse)
OKAG00090-96W 1 Plate: 12x 8 Well Microstrips

OKAG00090-96W - KC ELISA Kit (Mouse)

Sign In for Pricing
View Details
MASS1/GPR98 Rabbit pAb, PE-Cy5 conjugated
orb2863816 100 µL

MASS1/GPR98 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
PGK1P2 sgRNA CRISPR Lentivector set (Human)
K1634901 3x 1.0 µg

PGK1P2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GABAB R2 Antibody
B8506-01 50 μL

GABAB R2 Antibody

Sign In for Pricing
View Details
GABAB R2 Antibody
B8506-02 100 µL

GABAB R2 Antibody

Sign In for Pricing
View Details
Human KISS-54 (Kisspeptin-54) ELISA Kit
MBS2533433-01 24 Tests (Limit 1)

Human KISS-54 (Kisspeptin-54) ELISA Kit

Sign In for Pricing
View Details