Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium leprae 65 kDa heat shock protein (hsp65), partial

This Recombinant Mycobacterium leprae 65 kDa heat shock protein (hsp65), partial spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5U929

Expression Region

1-120aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium leprae

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGANPLGLKRGIEKAVDKVTETLLKDAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dopamine Receptor, D1a
D9014 50 µg

Dopamine Receptor, D1a

Sign In for Pricing
View Details
MD2-IN-1
C12020-01 2 mg

MD2-IN-1

Sign In for Pricing
View Details
MD2-IN-1
C12020-02 5 mg

MD2-IN-1

Sign In for Pricing
View Details
KRAS (NM_004985) Human Recombinant Protein
PH41122M5 20 µg

KRAS (NM_004985) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit GFAP (Glial Fibrillary Acidic Protein) ELISA Kit
orb3127184-01 48 Tests

Rabbit GFAP (Glial Fibrillary Acidic Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit GFAP (Glial Fibrillary Acidic Protein) ELISA Kit
orb3127184-02 96 Tests

Rabbit GFAP (Glial Fibrillary Acidic Protein) ELISA Kit

Sign In for Pricing
View Details