Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster 5-hydroxytryptamine receptor 2B (5-HT1B), partial

This Recombinant Drosophila melanogaster 5-hydroxytryptamine receptor 2B (5-HT1B), partial spans the amino acid sequence from region 278-534aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5-HT receptor 2B;5-hydroxytryptamine receptor 1B;5-HT receptor 1B; Serotonin receptor 1B; Serotonin receptor 2B

UniProt

P28286

Expression Region

278-534aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKRIQRRAQKSFNVTLTETDCDSAVRELKKERSKRRAERKRLEAGERTPVDGDGTGGQLQRRTRKRMRICFGRNTNTANVVAGSEGAVARSMAAIAVDFASLAITREETEFSTSNYDNKSHAGTELTTVSSDADDYRTSNANEIITLSQQVAHATQHHLIASHLNAITPLAQSIAMGGVGCLTTTTPSEKALSGAGTVAGAVAGGSGSGSGEEGAGTEGKNAGVGLGGVLASIANPHQKLAKRRQLLEAKRERKAAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCEL Antibody / Sciellin
RQ6114 100 µg

SCEL Antibody / Sciellin

Sign In for Pricing
View Details
TBRG1 (N-term) Rabbit Polyclonal Antibody
AP13465PU-N 400 µL

TBRG1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS645491 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Recombinant SMARCA5 Antibody
RC-4599-01 50 μL

Recombinant SMARCA5 Antibody

Sign In for Pricing
View Details
Recombinant SMARCA5 Antibody
RC-4599-02 100 µL

Recombinant SMARCA5 Antibody

Sign In for Pricing
View Details
Recombinant SMARCA5 Antibody
RC-4599-03 1 mL

Recombinant SMARCA5 Antibody

Sign In for Pricing
View Details