Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Protein UL141 (UL141), partial

This Recombinant Human cytomegalovirus Protein UL141 (UL141), partial spans the amino acid sequence from region 37-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6RJQ3

Expression Region

37-278aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIAEKMWAENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV6-POU2F1-3*FLAG
BZ64504 1 Vial

PCMV6-POU2F1-3*FLAG

Sign In for Pricing
View Details
Human MYOG knockdown cell line
ABC-KD9782 1 Vial

Human MYOG knockdown cell line

Sign In for Pricing
View Details
PE Rabbit anti-Human CD8 PolymAb® mAb
A28209PM-01 50 Tests

PE Rabbit anti-Human CD8 PolymAb® mAb

Sign In for Pricing
View Details
PE Rabbit anti-Human CD8 PolymAb® mAb
A28209PM-02 100 Tests

PE Rabbit anti-Human CD8 PolymAb® mAb

Sign In for Pricing
View Details
PE Rabbit anti-Human CD8 PolymAb® mAb
A28209PM-03 200 Tests

PE Rabbit anti-Human CD8 PolymAb® mAb

Sign In for Pricing
View Details
PE Rabbit anti-Human CD8 PolymAb® mAb
A28209PM-04 500 Tests

PE Rabbit anti-Human CD8 PolymAb® mAb

Sign In for Pricing
View Details