Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

This Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial spans the amino acid sequence from region 723-871aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

UniProt

Q9EPK8

Expression Region

723-871aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk6 Recombinant Rabbit monoclonal Antibody
HA750289 100 µL

Cdk6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Jagged1 (JAG1) (NM_000214) Human Over-expression Lysate
LY400079 100 µg

Jagged1 (JAG1) (NM_000214) Human Over-expression Lysate

Sign In for Pricing
View Details
Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody
HA751325 100 µL

Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
4-Isopropoxyphenylboronic Acid
TRC-I823420-10G 10 g

4-Isopropoxyphenylboronic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS509764 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
S100G (NM_004057) Human Over-expression Lysate
LY418249 100 µg

S100G (NM_004057) Human Over-expression Lysate

Sign In for Pricing
View Details