Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial
This Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial spans the amino acid sequence from region 736-827aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38
UniProt
Q4LDE5
Expression Region
736-827aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-500 1x 500 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880746-100 1x 100 µL
CD5 (CD5/54/F6), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400848-500 1x 500 µL
CD31 / PECAM-1 (C31.10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details