Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin-10 (IL10)

This Recombinant Rabbit Interleukin-10 (IL10) spans the amino acid sequence from region 19-178aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-10; Cytokine synthesis inhibitory factor; CSIF

UniProt

Q9TSJ4

Expression Region

19-178aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQLNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLRLRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc115 Mouse Gene Knockout Kit (CRISPR)
KN502640 1 Kit

Ccdc115 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELL2 (NM_012081) Human Over-expression Lysate
LC402140 20 µg

ELL2 (NM_012081) Human Over-expression Lysate

Sign In for Pricing
View Details
IFluor® 647 goat anti-rabbit IgG (H+L)
16642-AAT 200 µg

IFluor® 647 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
Mouse FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-M0511-01 24 Tests

Mouse FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Mouse FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-M0511-02 48 Tests

Mouse FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
Mouse FSH (Follicle Stimulating Hormone) ELISA Kit
E-EL-M0511-03 96 Tests

Mouse FSH (Follicle Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details