Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone deacetylase complex subunit SAP25 (SAP25)

This Recombinant Human Histone deacetylase complex subunit SAP25 (SAP25) spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

25 kDa Sin3-associated polypeptide; Sin3 corepressor complex subunit SAP25

UniProt

Q8TEE9

Expression Region

1-199aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18 protein
30R-3229 50 ug

KRT18 protein

Sign In for Pricing
View Details
MLL4 antibody - N-terminal region
MBS3201675-01 0.1 mL

MLL4 antibody - N-terminal region

Sign In for Pricing
View Details
MLL4 antibody - N-terminal region
MBS3201675-02 5x 0.1 mL

MLL4 antibody - N-terminal region

Sign In for Pricing
View Details
Olr767 (NM_001000611) Rat Tagged Lenti ORF Clone
RR211027L3 10 µg

Olr767 (NM_001000611) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hist1h4h sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4053503 1.0 µg DNA

Hist1h4h sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Lentiviral human CCNJ sgRNA gene knockout kit - Lentiviral human CCNJ sgRNA gene knockout kit (plasmid)
GTR15375776 1 Vial

Lentiviral human CCNJ sgRNA gene knockout kit - Lentiviral human CCNJ sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details