Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)

This Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) spans the amino acid sequence from region 38-175aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta; Reg III-beta

UniProt

P35230

Expression Region

38-175aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omt2a 3'UTR Lenti-reporter-Luc Vector
34817084 1.0 µg

Omt2a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CPSF3 AAV Vector (Mouse) (CMV)
16779104 1 µg

CPSF3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody
orb2959431-01 50 µg

HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody

Sign In for Pricing
View Details
HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody
orb2959431-02 100 µg

HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody

Sign In for Pricing
View Details
HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody
orb2959431-03 1 mg

HIV-1 Capsid protein p24/CA protein Human Monoclonal Antibody

Sign In for Pricing
View Details
Wge Antibody
orb808389 2 mg

Wge Antibody

Sign In for Pricing
View Details