Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial
This Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial spans the amino acid sequence from region 27-174aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
REG-3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma
UniProt
O09049
Expression Region
27-174aa
Tag
Tag-Free
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740043-100 1x 100 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0096-100 1x 100 µL
Histone H1 (AE-4), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881497-100 1x 100 µL
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681467-500 1x 500 µL
MCM7 (Proliferation Marker) (MCM7/1467), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details