Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dickkopf-related protein 2 (Dkk2)

This Recombinant Mouse Dickkopf-related protein 2 (Dkk2) spans the amino acid sequence from region 34-259aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dickkopf-2; Dkk-2; mDkk-2

UniProt

Q9QYZ8

Expression Region

34-259aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLNSIKSSLGGETPAQSANRSAGMNQGLAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMLCRRKKKRCHRDGMCCPGTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP35 Protein Vector (Mouse) (pPB-C-His)
PV207322 500 ng

NUP35 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human MTHFR shRNA (UAS) - Lentiviral human MTHFR shRNA (UAS, RFP) plasmid
GTR15342964 1 Vial

Lentiviral human MTHFR shRNA (UAS) - Lentiviral human MTHFR shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CACHD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
14872124 3x 1.0µg DNA

CACHD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Emr4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6152307 1.0 µg DNA

Emr4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Kinesis KX+ Premium Kit Packs2mL Amber w/patch; Screw Top Vial; PTFE/Rubber Septa
CHR1125 100 / PCK

Kinesis KX+ Premium Kit Packs2mL Amber w/patch; Screw Top Vial; PTFE/Rubber Septa

Sign In for Pricing
View Details
ADSSL1 siRNA (Mouse)
CRM0093-01 15 nmol

ADSSL1 siRNA (Mouse)

Sign In for Pricing
View Details