Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-2 complex subunit sigma (AP2S1)

This Recombinant Human AP-2 complex subunit sigma (AP2S1) spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin

UniProt

P53680

Expression Region

1-142aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASAL1 Rabbit pAb
E45R21664N-100 100 µL

RASAL1 Rabbit pAb

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-64864-01 60 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-64864-02 120 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-64864-03 200 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
Negr1 (NM_177274) Mouse Tagged ORF Clone
MR217362 10 µg

Negr1 (NM_177274) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
P-Chloro-N, N-diethylaniline-d10
461817-01 10 mg

P-Chloro-N, N-diethylaniline-d10

Sign In for Pricing
View Details