Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human parainfluenza 3 virus Nucleoprotein (N), partial

This Recombinant Human parainfluenza 3 virus Nucleoprotein (N), partial spans the amino acid sequence from region 1-400aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein; NP; Protein N

UniProt

P06159

Expression Region

1-400aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human parainfluenza 3 virus (strain Wash/47885/57) (HPIV-3) (Human parainfluenza 3 virus (strain NIH 47885) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSLFDTFNARRQENITKSAGGAIIPGQKNTVSIFALGPTITDDNEKMTLALLFLSHSLDNEKQHAQRAGFLVSLLSMAYANPELYLTTNGSNADVKYVIYMIEKDLKRQKYGGFVVKTREMIYEKTTEWIFGSDLDYDQETMLQNGRNNSTIEDLVHTFGYPSCLGALIIQIWIVLVKAITSISGLRKGFFTRLEAFRQDGTVQAGLVLSGDTVDQIGSIMRSQQSLVTLMVETLITMNTSRNDLTTIEKNIQIVGNYIRDAGLASFFNTIRYGIETRMAALTLSTLRPDINRLKALMELYLSKGPRAPFICILRDPIHGEFAPGNYPAIWSYAMGVAVVQNRAMQQYVTGRSYLDIDMFQLGQAVARDAEAQMSSTLEDELGVTHEAKESLKRHIRNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey MEPE ELISA Kit
EMKM0266 96 Tests

Monkey MEPE ELISA Kit

Sign In for Pricing
View Details
PCDHGA9 (Protocadherin gamma-A9, PCDH-gamma-A9, PCDH-GAMMA-A9) (HRP)
130979-HRP 100 µL

PCDHGA9 (Protocadherin gamma-A9, PCDH-gamma-A9, PCDH-GAMMA-A9) (HRP)

Sign In for Pricing
View Details
SPECC1, ID (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (Azide free) (HRP) discontinued
042220-HRP 200 µL

SPECC1, ID (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Fchsd1 Mouse shRNA Lentiviral Particle (Locus ID 319262)
TL511236V 500 µL Each

Fchsd1 Mouse shRNA Lentiviral Particle (Locus ID 319262)

Sign In for Pricing
View Details
Quantum™ PE-Cy™5 MESF
BLI828A-1 1 mL

Quantum™ PE-Cy™5 MESF

Sign In for Pricing
View Details
FER1L6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20456111 3x 1.0 µg

FER1L6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details