Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 2 (tdh2)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

FELPSVPFPAPGSDEILFVVRDTTFNTNAPVNVEVSDFWTNRNVKRKPYKDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKHGHSAVFVKSDQVQLQHSYDSVANFVGEDEDSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ